Myneta.info is an open data repository platform of Association for Democratic Reforms (ADR).
Myneta Logo Myneta Logo
Home Lok Sabha State Assemblies Rajya Sabha Political Parties Electoral Bonds || माय नेता हिंदी में || About MyNeta About ADR
State Assemblies Rajya Sabha Political Parties
1 2 3 4
HomeAndhra Pradesh 2019VISAKHAPATNAMNARSIPATNAMAYYANNA PATRUDU CHINTAKAYALA(Criminal & Asset Declaration)

Andhra Pradesh 2019

profile image

AYYANNA PATRUDU CHINTAKAYALA

NARSIPATNAM (VISAKHAPATNAM)
Party:TDP
S/o|D/o|W/o: Varahala Dora
Age: 62
Name Enrolled as Voter in: 34 Narsipatnam (Andhra Pradesh) constituency, at Serial no 303 in Part no 161

Self Profession:Salary and Politician
Spouse Profession:Business

Crime-O-Meter


No criminal cases

Assets & Liabilities


Assets: Rs 12,16,95,107 ~12 Crore+
Liabilities: Rs 5,05,54,282 ~5 Crore+

Educational Details


Category: 12th Pass
Intermediate From Board of Intermediates Education In 1975

Details of PAN and status of Income Tax return

Relation TypePAN GivenFinancial YearTotal Income Shown in ITR
selfY2018 - 20192018 - 2019 ** Rs 43,41,933 ~ 43 Lacs+
2017 - 2018 ** Rs 54,04,228 ~ 54 Lacs+
2016 - 2017 ** Rs 49,74,988 ~ 49 Lacs+
2015 - 2016 ** Rs 31,16,140 ~ 31 Lacs+
2014 - 2015 ** Rs 12,22,853 ~ 12 Lacs+
spouseY2018 - 20192018 - 2019 ** Rs 17,43,474 ~ 17 Lacs+
2017 - 2018 ** Rs 10,92,988 ~ 10 Lacs+
2016 - 2017 ** Rs 8,57,249 ~ 8 Lacs+
2015 - 2016 ** Rs 7,93,712 ~ 7 Lacs+
2014 - 2015 ** Rs 7,75,896 ~ 7 Lacs+
hufY2016 - 20172018 - 2019 ** Rs 0 ~
2017 - 2018 ** Rs 0 ~
2016 - 2017 ** Rs 84,000 ~ 84 Thou+
2015 - 2016 ** Rs 85,219 ~ 85 Thou+
2014 - 2015 ** Rs 86,777 ~ 86 Thou+
dependent1Y2018 - 20192018 - 2019 ** Rs 5,77,470 ~ 5 Lacs+
2017 - 2018 ** Rs 7,77,172 ~ 7 Lacs+
2016 - 2017 ** Rs 3,89,760 ~ 3 Lacs+
2015 - 2016 ** Rs 3,52,930 ~ 3 Lacs+
2014 - 2015 ** Rs 0 ~
dependent2 ** Nil
** Nil
** Nil
** Nil
** Nil
dependent3 ** Nil
** Nil
** Nil
** Nil
** Nil
Data Readability Report of PAN and Income Tax :No Problems in Reading Affidavit Information

Details of Criminal Cases

No criminal cases

Disclaimer: This information is an archive of the candidate's self-declared affidavit that was filed during the elections. The current status of this information may be different. For the latest available information, please refer to the affidavit filed by the candidate to the Election Commission in the most recent election.

Data Readability Report of Criminal Cases :No Problems in Reading Affidavit Information

Details of Movable Assets

Sr NoDescriptionselfspousehufdependent1dependent2dependent3
iCash 3,93,912  3 Lacs+

1,35,000  1 Lacs+

25,000  25 Thou+

95,000  95 Thou+

NilNil Rs 6,48,912
6 Lacs+
iiDeposits in Banks, Financial Institutions and Non-Banking Financial CompaniesAndhra Bank Narsipatnam a/c no.038310021050
1,01,800  1 Lacs+

state bank of india narsipatnam a/c no.38337812646
1,27,073  1 Lacs+

state bank of hyderabad a/c no.52088484142
22,65,075  22 Lacs+

bank of india vizag a/c no.861710100100
1,21,348  1 Lacs+

SBI sriripuram a/c no 33849973924
19,187  19 Thou+

Andhra bank narsipatnam a/c no 038310027000768
3,81,576  3 Lacs+

state bank of india narsipatnam a/c no 32234050061
6,80,464  6 Lacs+

state bank of hyderabad golugonda a/c no.62170494923
2,54,717  2 Lacs+

state bank of india visakhapatnam a/c no.302289302532
30,758  30 Thou+

state bank of india narsipatnam FD
3,00,000  3 Lacs+

Nilandhra nank narsipatnam a/c no.038310011016356
21,202  21 Thou+

sate bank of india narsipatnam a/c no.20204252233
1,57,189  1 Lacs+

HDFC bank viskhapatnam a/c no.04171530024600
7,822  7 Thou+

NilNil Rs 44,68,211
44 Lacs+
iiiBonds, Debentures and Shares in companiesSunray green space pvt ltd 20000 eqty shares
2,00,000  2 Lacs+

sunray resorts pvt ltd 20000 equity shares
2,00,000  2 Lacs+

ranvar Agrochem ltd 35000 eqty shares
3,50,000  3 Lacs+

Sunray green space pvt ltd 293500 eqty shares
29,35,000  29 Lacs+

Sunray resorts pvt ltd 19000 equity shares
1,90,000  1 Lacs+

RANVAR AGROCHEN LTD 35000 EQTY SHARES
3,50,000  3 Lacs+

NilVisaakha Distilers lit
2,90,60,000  2 Crore+

NilNil Rs 3,32,85,000
3 Crore+
iv(a)
NSS, Postal Savings etc
NilNilNilNilNilNil Nil
(b)
LIC or other insurance Policies
LIC Policy no 693557557
6,41,655  6 Lacs+

ILC policy no 694919963
13,21,804  13 Lacs+

SBI life
1,00,000  1 Lacs+

Margadasi chits
15,77,416  15 Lacs+

NilLIC policy no 6938088995
6,12,248  6 Lacs+

NilNil Rs 42,53,123
42 Lacs+
vPersonal loans/advance given Chodavaram co-op sugars society 1000 shares
1,000  1 Thou+

Chodavaram co-op sugars society 1000 shares
1,000  1 Thou+

NilNilNilNil Rs 2,000
2 Thou+
viMotor Vehicles (details of make, etc.)Innova 2014 AP31CP4599
22,00,000  22 Lacs+

Mahindra Jeep AP5499
30,000  30 Thou+

Swift 2014 AP314599
5,54,000  5 Lacs+

Fortuner car TS09ET6446
37,29,000  37 Lacs+

NilTATA EXNON Picup AP 31 TM 2112
3,10,000  3 Lacs+

NilNil Rs 68,23,000
68 Lacs+
viiJewellery (give details weight value)Gold 100 grms
3,00,000  3 Lacs+

Gold 900 grms
27,00,000  27 Lacs+

Silver 4 kgs
2,00,000  2 Lacs+

NilNilNilNil Rs 32,00,000
32 Lacs+
viiiOther assets, such as values of claims / interestsNilNilNilNilNilNil Nil
Gross Total Value (as per Affidavit) 69,51,050  69 Lacs+ 1,54,50,735  1 Crore+ 25,000  25 Thou+ 3,02,63,461  3 Crore+ Nil Nil Rs 5,26,90,246
5 Crore+
Totals (Calculated as Sum of Values) Rs 69,51,050
69 Lacs+
Rs 1,54,40,735
1 Crore+
Rs 25,000
25 Thou+
Rs 3,02,63,461
3 Crore+
Nil
Nil
Rs 5,26,80,246
5 Crore+

Disclaimer: This information is an archive of the candidate's self-declared affidavit that was filed during the elections. The current status of this information may be different. For the latest available information, please refer to the affidavit filed by the candidate to the Election Commission in the most recent election.

Data Readability Report of Movable Assets :No Problems in Reading Affidavit Information

Details of Immovable Assets

Sr NoDescriptionselfspousehufdependent1dependent2dependent3
iAgricultural LandGabbads s.no 191-3
Total Area 0.72
Built Up Area
Whether Inherited Y
Purchase Date 0000-00-00
Purchase Cost 0.00
Development Cost 0.00
5,04,000  5 Lacs+

Gabbadas s.no 191-10
Total Area 0.73
Built Up Area
Whether Inherited Y
Purchase Date 0000-00-00
Purchase Cost 0.00
Development Cost 0.00
5,11,000  5 Lacs+

Allipudi E.G.S no 261
Total Area 2.08
Built Up Area
Whether Inherited Y
Purchase Date 0000-00-00
Purchase Cost 0.00
Development Cost 0.00
11,44,000  11 Lacs+

Narsipatnam s.no 229
Total Area 4.76
Built Up Area
Whether Inherited Y
Purchase Date 0000-00-00
Purchase Cost 0.00
Development Cost 0.00
74,97,000  74 Lacs+

Narsipatnam s.no 224
Total Area 0.50
Built Up Area
Whether Inherited Y
Purchase Date 0000-00-00
Purchase Cost 0.00
Development Cost 0.00
7,87,500  7 Lacs+

Cheedigummala s.no 88, 89, 93 7, 93, 106-7, 111-5, 112, 96,106-3, 107 111-1
Total Area 15.27
Built Up Area
Whether Inherited Y
Purchase Date 0000-00-00
Purchase Cost 0.00
Development Cost 0.00
91,62,000  91 Lacs+

Narsipatnam s.no 278-1
Total Area 0.44
Built Up Area
Whether Inherited N
Purchase Date 0000-00-00
Purchase Cost 748000.00
Development Cost 0.00
7,48,000  7 Lacs+

NilDharmasagaram s.no 67 and 65
Total Area 1.67
Built Up Area
Whether Inherited N
Purchase Date 0000-00-00
Purchase Cost 335000.00
Development Cost 0.00
11,69,000  11 Lacs+

Narsipatnam s.no 231-3
Total Area 0.95
Built Up Area
Whether Inherited N
Purchase Date 0000-00-00
Purchase Cost 1425000.00
Development Cost 0.00
14,96,250  14 Lacs+

NilNil Rs 2,30,18,750
2 Crore+
iiNon Agricultural LandPedaboddepallio s.no 54-3
Total Area 0.37
Built Up Area
Whether Inherited N
Purchase Date 0000-00-00
Purchase Cost 37000.00
Development Cost 0.00
2,59,000  2 Lacs+

narsapatanm s.no 132-3
Total Area 61
Built Up Area
Whether Inherited N
Purchase Date 0000-00-00
Purchase Cost 9200.00
Development Cost 0.00
1,22,000  1 Lacs+

narsipatnam 132-3
Total Area 123
Built Up Area
Whether Inherited N
Purchase Date 0000-00-00
Purchase Cost 18500.00
Development Cost 0.00
2,46,000  2 Lacs+

narsipatnam 1/4 th shared vacant site beside tiled house
Total Area 1472
Built Up Area
Whether Inherited Y
Purchase Date 0000-00-00
Purchase Cost 18500.00
Development Cost 0.00
3,22,111  3 Lacs+

RR dist bommaraspet s.no 371 387 388
Total Area 1000
Built Up Area
Whether Inherited N
Purchase Date 0000-00-00
Purchase Cost 100000.00
Development Cost 0.00
6,00,000  6 Lacs+

Pedaboddepalli s.no
Total Area 901.5
Built Up Area
Whether Inherited Y
Purchase Date 0000-00-00
Purchase Cost 0.00
Development Cost 0.00
18,03,000  18 Lacs+

pedaboddepalli s.no 359-2
Total Area 2420
Built Up Area
Whether Inherited Y
Purchase Date 0000-00-00
Purchase Cost 0.00
Development Cost 0.00
48,40,000  48 Lacs+

pedaboddepalli s.no 359-2
Total Area 1170
Built Up Area
Whether Inherited N
Purchase Date 0000-00-00
Purchase Cost 550000.00
Development Cost 0.00
23,40,000  23 Lacs+

balighattam s.no49-2B/1
Total Area 444.5
Built Up Area
Whether Inherited N
Purchase Date 0000-00-00
Purchase Cost 102500.00
Development Cost 0.00
8,89,000  8 Lacs+

narsipatnam 169 ward no3 block no 13
Total Area 400
Built Up Area
Whether Inherited N
Purchase Date 0000-00-00
Purchase Cost 48000.00
Development Cost 0.00
8,00,000  8 Lacs+

pedaboddepalli s.no 328
Total Area 320
Built Up Area
Whether Inherited N
Purchase Date 0000-00-00
Purchase Cost 480000.00
Development Cost 0.00
6,40,000  6 Lacs+

Nilnarsipatnam s.no 237
Total Area 234.61
Built Up Area
Whether Inherited N
Purchase Date 0000-00-00
Purchase Cost 470000.00
Development Cost 0.00
4,70,000  4 Lacs+

NilNil Rs 1,33,31,111
1 Crore+
iiiCommercial BuildingsNiljoint owershipo 22 rd floor 50% nshare golf edge apartment rangareddy dist telengana commercial space s.no 27/1-4
Total Area 11765
Built Up Area
Whether Inherited N
Purchase Date 0000-00-00
Purchase Cost 0.00
Development Cost 0.00
1,50,00,000  1 Crore+

NilNilNilNil Rs 1,50,00,000
1 Crore+
ivResidential BuildingsDeepanjali Apartment Siripuram Visakhaptanam S NO 79
Total Area 1152 Sq.ft.
Built Up Area 2766 Sq.ft.
Whether Inherited N
Purchase Date 2001-12-01
Purchase Cost 1202000.00
Development Cost 0.00
70,00,000  70 Lacs+

G+1 Floor House 1/4 Share Narsipatnam Sy no 132-2
Total Area 484 Sq.yrd.
Built Up Area 6383 Sq.ft.
Whether Inherited N
Purchase Date 0000-00-00
Purchase Cost 0.00
Development Cost 0.00
25,00,000  25 Lacs+

1/4th Share In tiled House S No 132-2 Narasipatnam
Total Area 580 Sq.ft.
Built Up Area 4352 Sq.ft.
Whether Inherited N
Purchase Date 0000-00-00
Purchase Cost 0.00
Development Cost 0.00
1,50,000  1 Lacs+

excelosir apartment ramnagar vishka patnam Ts no 108-8 s.no 1196/18 and S
Total Area 27.5
Built Up Area 1200
Whether Inherited Y
Purchase Date 0000-00-00
Purchase Cost 0.00
Development Cost 198000.00
30,00,000  30 Lacs+

NilNARSIPATNAM VISALAKSHINAGAR plot no 68 s.no 483/3 residential houes
Total Area 183.33
Built Up Area 183.33
Whether Inherited N
Purchase Date 0000-00-00
Purchase Cost 24.00
Development Cost 4500000.00
50,00,000  50 Lacs+

NilNil Rs 1,76,50,000
1 Crore+
vOthersNilNilNilNilNilNil Nil
Total Current Market Value of (i) to (v) (as per Affidavit) 2,16,47,611  2 Crore+ 3,92,22,000  3 Crore+ Nil 81,35,250  81 Lacs+ Nil Nil Rs 6,90,04,861
6 Crore+
Totals Calculated Rs 2,16,42,611
2 Crore+
Rs 3,92,22,000
3 Crore+
Nil
Rs 81,35,250
81 Lacs+
Nil
Nil
Rs 6,89,99,861
6 Crore+

Disclaimer: This information is an archive of the candidate's self-declared affidavit that was filed during the elections. The current status of this information may be different. For the latest available information, please refer to the affidavit filed by the candidate to the Election Commission in the most recent election.

Data Readability Report of Immovable Assets :No Problems in Reading Affidavit Information

Details of Liabilities

Sr NoDescriptionselfspousehufdependent1dependent2dependent3
iLoans from Banks / FIsNilHDFC Car loan TOYOTO FORTUNER
22,97,000  22 Lacs+

NilSBI Narsipatnam housing loan
28,67,282  28 Lacs+

NilNil Rs 51,64,282
51 Lacs+
Loans due to Individual / EntityNilSantiam Estated Pvt. ltd.
60,00,000  60 Lacs+

Sri. Narahari Pullayya
45,00,000  45 Lacs+

Sri Surya Venkata Subba Rao
55,00,000  55 Lacs+

Rajkamal Poultries Pvt. ltd.
1,80,000  1 Lacs+

I.A.Raja Varma
7,00,000  7 Lacs+

NilN.Teja
22,00,000  22 Lacs+

K.Rajiv
50,00,000  50 Lacs+

Surjana Kumari
35,00,000  35 Lacs+

PR Infra Avenues Pvt. ltd.
50,00,000  50 Lacs+

Srivari Infra
24,50,000  24 Lacs+

Chaitanya Murali Krishna
10,00,000  10 Lacs+

Kannam Naidu
8,00,000  8 Lacs+

Haigreeva Infra Projects Pvt. ltd.
34,60,000  34 Lacs+

Y. Jayalakshmi
51,00,000  51 Lacs+

NilNil Rs 4,53,90,000
4 Crore+
Any other LiabilityNilNilNilNilNilNil Nil
Grand Total of Liabilities (as per affidavit) Nil 1,91,77,000  1 Crore+ Nil 3,13,77,282  3 Crore+ Nil Nil Rs 5,05,54,282
5 Crore+
iiDues to departments dealing with government accommodationNilNilNilNilNilNil Nil
Dues to departments dealing with supply of waterNilNilNilNilNilNil Nil
Dues to departments dealing with supply of electricityNilNilNilNilNilNil Nil
Dues to departments dealing with telephonesNilNilNilNilNilNil Nil
Dues to departments dealing with supply of transportNilNilNilNilNilNil Nil
Income Tax DuesNilNilNilNilNilNil Nil
Wealth Tax DuesNilNilNilNilNilNil Nil
Service Tax DuesNilNilNilNilNilNil Nil
Property Tax DuesNilNilNilNilNilNil Nil
Sales Tax DuesNilNilNilNilNilNil Nil
GST DuesNilNilNilNilNilNil Nil
Any Other DuesNilNilNilNilNilNil Nil
iiiGrand Total of all Govt Dues (as per affidavit) Nil Nil Nil Nil Nil Nil Nil
ivWhether any other liabilities are in dispute, if so, mention the amount involved and the authority before which it is pendingNilNilNilNilNilNil Nil
Totals (Calculated as Sum of Values) Nil
Rs 1,91,77,000
1 Crore+
Nil
Rs 3,13,77,282
3 Crore+
Nil
Nil
Rs 5,05,54,282
5 Crore+

Disclaimer: This information is an archive of the candidate's self-declared affidavit that was filed during the elections. The current status of this information may be different. For the latest available information, please refer to the affidavit filed by the candidate to the Election Commission in the most recent election.

Data Readability Report of Liabilities :No Problems in Reading Affidavit Information

Profession or Occupation

Self Salary and Politician
Spouse Business

Sources Of Income (Details)

Self Salary
Spouse Business and Agriculture Income
Dependent Business

Contracts with appropriate Govt. and any public company/companies

Details of contracts entered by the candidate NIL
Details of contracts entered into by spouse NIL
Details of contracts entered into by dependent NIL
Details of contracts entered into by Hindu undivided family or trust in which the candidate or spouse or dependents have interest NIL
Details of contracts entered into by Partnership Firms in which the candidate or spouse or dependents are partners NIL
Details of contracts entered into by Private Companies in which candidate or spouse or dependents have share NIL



If you notice any discrepancy between affidavits and our data, you can use the message box below to send a message to us.

( यदि आप हलफनामों और इस पेज पर दी गयी जानकारी के बीच कोई विसंगति/भिन्नता पाते है तो आप नीचे के संदेश बॉक्स के उपयोग से हमें संदेश भेज सकते हैं)

Name
Email
Phone No
Enter your discrepancy
Please enter the code shown below and click Submit.




Share On:
Download App Follow us on

Disclaimer: All information on this website has been taken by ADR from the website of the Election Commission of India (https://affidavitarchive.nic.in/) and all the information is available in public domain. ADR does not add or subtract any information, unless the EC changes the data. In particular, no unverified information from any other source is used. While all efforts have been made by ADR to ensure that the information is in keeping with what is available in the ECI website, in case of discrepancy between information provided by ADR through this report, anyone and that given in the ECI website, the information available on the ECI website should be treated as correct and Association for Democratic Reforms and their volunteers are not responsible or liable for any direct, indirect special, or consequential damages, claims, demands, losses of any kind whatsoever, made, claimed, incurred or suffered by any party arising under or relating to the usage of data provided by ADR through this report. It is to be noted that ADR undertakes great care and adopts utmost due diligence in analysing and dissemination of the background information of the candidates furnished by them at the time of elections from the duly self-sworn affidavits submitted with the Election Commission of India. Such information is only aimed at highlighting the growing criminality in politics, increased misuse of money in elections so as to facilitate a system of transparency, accountability and good governance and to enable voters to form an informed choice. Therefore, it is expected that anyone using this report shall undertake due care and utmost precaution while using the data provided by ADR. ADR is not responsible for any mishandling, discrepancy, inability to understand, misinterpretation or manipulation, distortion of the data in such a way so as to benefit or target a particular political party or politician or candidate.

About MyNeta About ADR State Coordinators Contact Terms of Use FAQs