Myneta.info is an open data repository platform of Association for Democratic Reforms (ADR).
Myneta Logo Myneta Logo
Home Lok Sabha State Assemblies Rajya Sabha Political Parties Electoral Bonds || माय नेता हिंदी में || About MyNeta About ADR
State Assemblies Rajya Sabha Political Parties
1 2 3 4
HomeAndhra Pradesh 2019VISAKHAPATNAMYELAMANCHILIPANCHAKARLA RAMESH BABU(Criminal & Asset Declaration)

Andhra Pradesh 2019

profile image

PANCHAKARLA RAMESH BABU

YELAMANCHILI (VISAKHAPATNAM)
Party:TDP
S/o|D/o|W/o: Late Panchakarla Pandu Ranga Rao
Age: 54
Name Enrolled as Voter in: 23 Visakhapatnam North constituency, at Serial no 366 in Part no 178

Self Profession:Politician
Spouse Profession:House wife

Other Elections
Declaration inDeclared AssetsDeclared Cases
Andhra Pradesh 2024Rs16,07,60,795
~16 Crore+
0
Andhra Pradesh 2014Rs10,53,25,444
~10 Crore+
2
Andhra Pradesh 2009Rs2,49,07,920
~2 Crore+
0
Andhra Pradesh 2009Rs6,24,000
~6 Lacs+
0
Click here for more details

Print Profile
View Candidate Election Expenses



Crime-O-Meter


Number of Criminal Cases: 1

Assets & Liabilities


Assets: Rs 21,13,13,034 ~21 Crore+
Liabilities: Rs 6,47,43,336 ~6 Crore+

Educational Details


Category: 10th Pass
9th Class In 1980 From C.P.M. High School Chilakalapudi, Machilipatnam

Details of PAN and status of Income Tax return

Relation TypePAN GivenFinancial YearTotal Income Shown in ITR
selfY2017 - 20182017 - 2018 ** Rs 7,35,932 ~ 7 Lacs+
None ** Rs 5,17,482 ~ 5 Lacs+
None ** Rs 10,66,477 ~ 10 Lacs+
None ** Rs 11,90,920 ~ 11 Lacs+
None ** Rs 12,94,670 ~ 12 Lacs+
spouseY2017 - 20182017 - 2018 ** Rs 1,62,921 ~ 1 Lacs+
None ** Rs 8,34,598 ~ 8 Lacs+
None ** Rs 8,48,348 ~ 8 Lacs+
None ** Rs 13,00,411 ~ 13 Lacs+
None ** Rs 16,83,346 ~ 16 Lacs+
hufNNoneNone ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
dependent1YNoneNone ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
dependent2YNoneNone ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
dependent3NNoneNone ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
Data Readability Report of PAN and Income Tax :No Problems in Reading Affidavit Information

Details of Criminal Cases

Brief Details of IPC / BNS

Cases where Pending

Serial No.FIR No.Case No.CourtIPC Sections ApplicableOther Details / Other Acts / Sections Applicable Charges Framed Date on which charges were framedAppeal FiledDetails and present status of appeal
1 CR No 107/2009, Date- 05.04.2009, Station House Officer, Pendurthi Law And Order Police Station, Pendurthi, Visakhapatnam, AP CC No 64/2018 Special Court For Trial of Criminal Cases Relating to Elected MPs & MLAs At Vijayawada, AP Section 32 of Police Act, Yes 05 Oct 2018Yes (IIIrd Metropolitan Magistrate Court At Visakhapatnam Vide CC No- 428/2018) The Honorable High Court of Judicature of AP At Hyderabad Vide Criminal Petition no 6489 of 2011 & CRL.P.MP NO 6648 OF 2011 The Honorable Justice Raja Elango, Order the Matter "There Shall be Interim Stay" On 03.08.2011, Directing to IIIrd M.M.C, Visakhapatnam & The Same Stay Order Coming on For Hearing on 20.10.2017 Before the Honorable High Court of Judicature At Hyderabad for The State of Telangana & The State of AP, Justice Shri T. Amarnath Goud, Then Stay Vacated & Directed The Sho Pendurthi P.S To Investigate And To File Final Report Before the Lower Court, The Concerned S.H.O Filed Charge Sheet on 14.05.2018 Before the IIIrd M.M.C. Visakhapatnam And As Per The Govt. of A.P.G.O. No 250 Date of 03.04.2018. Basing on The Said G.O. This Case Transferred From Visakhapatnam IIIrd MMC Court To Vijayawada Special Court.

Cases where Convicted

Serial No.Case No.CourtIPC Sections ApplicableOther Details / Other Acts / Sections Applicable Punishment ImposedDate on which convictedAppeal FiledDetails and present status of appeal
---------No Cases--------

Disclaimer: This information is an archive of the candidate's self-declared affidavit that was filed during the elections. The current status of this information may be different. For the latest available information, please refer to the affidavit filed by the candidate to the Election Commission in the most recent election.

Data Readability Report of Criminal Cases :No Problems in Reading Affidavit Information

Details of Movable Assets

Sr NoDescriptionselfspousehufdependent1dependent2dependent3
iCash 1,25,335  1 Lacs+

63,420  63 Thou+

NilNilNilNil Rs 1,88,755
1 Lacs+
iiDeposits in Banks, Financial Institutions and Non-Banking Financial CompaniesICICI bank ltd No 00600150xxxxx as on 2018-03-31
1,91,746  1 Lacs+

indian overseas bank 9joint ac) No 144601000012xxxxx
 

indian overseas bank No 14460100001xxxxx as on 2018-03-31
12,018  12 Thou+

Kotak mahindra bank No 33301003xxxxx as on 2018-03-31
10,109  10 Thou+

SBI as on 2018-03-31 No 6209833xxxxx
5,30,547  5 Lacs+

saving ac axis bank ltd as on 2018-03-31 No 91201002359xxxxx
26,825  26 Thou+

Indian overseas bank as on 2018-04-17 No 14460100001xxxxx
7,614  7 Thou+

central bank of india No 352874xxxxx as on 2018-04-17
23,331  23 Thou+

S.B ac Indian overseas bank No 14460100001xxxxx as on 2018-03-31
115  1 Hund+

andhra bank No 06081010016xxxxx as on 2018-03-31
2,917  2 Thou+

SB ac SBI No 2028685xxxxx as on 2018-03-31
6,780  6 Thou+

kotak mahindra bank No 241253xxxxx
4,059  4 Thou+

NilNil Rs 8,16,062
8 Lacs+
iiiBonds, Debentures and Shares in companies255000 shares of Rs 10 each in emmar logistics(p) ltd as on 2018-03-31
25,50,000  25 Lacs+

5000 shares of Rs 10 each in mega brothers infra project ltd as on 2018-03-31
50,000  50 Thou+

505000 shares of Rs 10 each in ranganadh trade impex ltd as on 2018-03-31
50,50,000  50 Lacs+

sundaram mutual fund as on 2018-03-31
1,11,839  1 Lacs+

255000 shares of Rs 10 each in emmar logistrics Ltd as on 2018-03-31
25,50,000  25 Lacs+

NilNilNilNil Rs 1,03,11,839
1 Crore+
iv(a)
NSS, Postal Savings etc
NilNilNilNilNilNil Nil
(b)
LIC or other insurance Policies
bajaj allianz insurgence co ltd
50,000  50 Thou+

LIC
62,49,264  62 Lacs+

Aviva L.I.
30,000  30 Thou+

LIC
13,31,440  13 Lacs+

LIC of india
2,71,125  2 Lacs+

LIC of India
19,458  19 Thou+

NilNil Rs 79,51,287
79 Lacs+
vPersonal loans/advance given B.Sridhar/B nirmala
10,50,000  10 Lacs+

Essemm intrapoat services
5,50,000  5 Lacs+

KS naidu
90,212  90 Thou+

P mahalakshmi
25,02,295  25 Lacs+

P venkateswara Rao
7,93,763  7 Lacs+

sairam interiors
5,56,728  5 Lacs+

SN murty
5,05,000  5 Lacs+

VR kumari
10,00,000  10 Lacs+

V prasad emmar logistics ltd
44,99,941  44 Lacs+

Receivable from gov of AP
1,75,000  1 Lacs+

V. Prasad Emmar Logistics
1,50,000  1 Lacs+

loans and advances as on 2018-03-31 emmar logistics ltd
35,00,059  35 Lacs+

NilNilNilNil Rs 1,53,72,998
1 Crore+
viMotor Vehicles (details of make, etc.)NilNilNilNilNilNil Nil
viiJewellery (give details weight value)100 grms & jewellery
1,58,054  1 Lacs+

600 grms gold & jewellery
14,55,987  14 Lacs+

NilNilNilNil Rs 16,14,041
16 Lacs+
viiiOther assets, such as values of claims / interestsNilIT refund
49,357  49 Thou+

TDS
66,460  66 Thou+

NilNilNilNil Rs 1,15,817
1 Lacs+
Gross Total Value (as per Affidavit) 2,69,61,852  2 Crore+ 91,04,493  91 Lacs+ 2,74,157  2 Lacs+ 30,297  30 Thou+ Nil Nil Rs 3,63,70,799
3 Crore+
Totals (Calculated as Sum of Values) Rs 2,69,61,852
2 Crore+
Rs 91,04,493
91 Lacs+
Rs 2,74,157
2 Lacs+
Rs 30,297
30 Thou+
Nil
Nil
Rs 3,63,70,799
3 Crore+

Disclaimer: This information is an archive of the candidate's self-declared affidavit that was filed during the elections. The current status of this information may be different. For the latest available information, please refer to the affidavit filed by the candidate to the Election Commission in the most recent election.

Data Readability Report of Movable Assets :No Problems in Reading Affidavit Information

Details of Immovable Assets

Sr NoDescriptionselfspousehufdependent1dependent2dependent3
iAgricultural LandNilRV palli krishna dist sy no 1-2
Total Area 2.00 acrs
Built Up Area
Whether Inherited Y
Purchase Date 0000-00-00
Purchase Cost 0.00
Development Cost 0.00
20,00,000  20 Lacs+

NilNilNilNil Rs 20,00,000
20 Lacs+
iiNon Agricultural Landplot macchilipatnam krishna dt RS no 198
Total Area 2023 sq yrds
Built Up Area
Whether Inherited N
Purchase Date 2008-07-08
Purchase Cost 2268960.00
Development Cost 0.00
1,86,94,400  1 Crore+

mekavari palem krishna dt s.no 48/B3/2
Total Area 19844 sq yrds
Built Up Area
Whether Inherited N
Purchase Date 1994-01-03
Purchase Cost 80000.00
Development Cost 0.00
4,16,72,400  4 Crore+

plot machilipatnam krishna dist sy no 198
Total Area 2032.00 sq yrds
Built Up Area
Whether Inherited N
Purchase Date 2008-06-27
Purchase Cost 2268960.00
Development Cost 0.00
1,86,94,400  1 Crore+

NilNilNilNil Rs 7,90,61,200
7 Crore+
iiiCommercial BuildingsNilNilNilNilNilNil Nil
ivResidential BuildingsRes. house- machilipatam, krishna dist d.no 20/118-4-1 RS no 385
Total Area 808.70 sq yrds
Built Up Area 2065.00 sq ft
Whether Inherited N
Purchase Date 2008-01-31
Purchase Cost 2538765.00
Development Cost 0.00
1,32,46,575  1 Crore+

Res house plot 12 VUDA layout madhurawada, vizag sno 131/2
Total Area 249.43 sq yrds
Built Up Area 3366.00 sq ft
Whether Inherited N
Purchase Date 2011-03-31
Purchase Cost 3084640.00
Development Cost 6577420.00
1,22,13,860  1 Crore+

Res building 50-121-30/A BS layout, vizag s No 1/1A of resapuvani palem (held in joint names)
Total Area 487.00 sq yrds
Built Up Area 4280.00 sq ft
Whether Inherited N
Purchase Date 2012-06-15
Purchase Cost 20424550.00
Development Cost 7349364.00
5,06,49,000  5 Crore+

Res bulding at veduruvada vill, visakhapatnam dist s.no 44-4 & 5
Total Area 1694.00 sq yrds
Built Up Area 14000.00 sq ft
Whether Inherited N
Purchase Date 2016-02-15
Purchase Cost 1437675.00
Development Cost 14063208.00
1,77,71,600  1 Crore+

NilNilNilNil Rs 9,38,81,035
9 Crore+
vOthersNilNilNilNilNilNil Nil
Total Current Market Value of (i) to (v) (as per Affidavit) 8,58,27,235  8 Crore+ 8,91,15,000  8 Crore+ Nil Nil Nil Nil Rs 17,49,42,235
17 Crore+
Totals Calculated Rs 8,58,27,235
8 Crore+
Rs 8,91,15,000
8 Crore+
Nil
Nil
Nil
Nil
Rs 17,49,42,235
17 Crore+

Disclaimer: This information is an archive of the candidate's self-declared affidavit that was filed during the elections. The current status of this information may be different. For the latest available information, please refer to the affidavit filed by the candidate to the Election Commission in the most recent election.

Data Readability Report of Immovable Assets :No Problems in Reading Affidavit Information

Details of Liabilities

Sr NoDescriptionselfspousehufdependent1dependent2dependent3
iLoans from Banks / FIsindian overseas bank home loan as on 2018-03-31
52,51,860  52 Lacs+

LIC of india loan on LIP as on 2018-03-31
26,71,500  26 Lacs+

Indian overseas bank home loan B.S layout 50-121-30/30A as on 2018-03-31
1,83,82,771  1 Crore+

LIC of india loan on LIP as on 2018-03-31
8,38,750  8 Lacs+

NilNilNilNil Rs 2,71,44,881
2 Crore+
Loans due to Individual / EntityCH subramanyam
1,00,000  1 Lacs+

M.P raghunadh
5,00,000  5 Lacs+

MV prasada Rao
3,00,000  3 Lacs+

NN construction
3,00,000  3 Lacs+

other unsecured loans
20,00,000  20 Lacs+

gopala krishna engineering
40,00,000  40 Lacs+

lorven building
14,25,500  14 Lacs+

haigreeva infratech
1,00,00,000  1 Crore+

loan from gov of AP as on 2018-03-31
16,01,000  16 Lacs+

P.Ramesh Babu
25,02,295  25 Lacs+

PV Rao
1,46,69,660  1 Crore+

MV prasada Rao
2,00,000  2 Lacs+

NilNilNilNil Rs 3,75,98,455
3 Crore+
Any other LiabilityNilNilNilNilNilNil Nil
Grand Total of Liabilities (as per affidavit) 2,81,49,860  2 Crore+ 3,65,93,476  3 Crore+ Nil Nil Nil Nil Rs 6,47,43,336
6 Crore+
iiDues to departments dealing with government accommodationNilNilNilNilNilNil Nil
Dues to departments dealing with supply of waterNilNilNilNilNilNil Nil
Dues to departments dealing with supply of electricityNilNilNilNilNilNil Nil
Dues to departments dealing with telephonesNilNilNilNilNilNil Nil
Dues to departments dealing with supply of transportNilNilNilNilNilNil Nil
Income Tax DuesNilNilNilNilNilNil Nil
Wealth Tax DuesNilNilNilNilNilNil Nil
Service Tax DuesNilNilNilNilNilNil Nil
Property Tax DuesNilNilNilNilNilNil Nil
Sales Tax DuesNilNilNilNilNilNil Nil
GST DuesNilNilNilNilNilNil Nil
Any Other DuesNilNilNilNilNilNil Nil
iiiGrand Total of all Govt Dues (as per affidavit) Nil Nil Nil Nil Nil Nil Nil
ivWhether any other liabilities are in dispute, if so, mention the amount involved and the authority before which it is pendingNilNilNilNilNilNil Nil
Totals (Calculated as Sum of Values) Rs 2,81,49,860
2 Crore+
Rs 3,65,93,476
3 Crore+
Nil
Nil
Nil
Nil
Rs 6,47,43,336
6 Crore+

Disclaimer: This information is an archive of the candidate's self-declared affidavit that was filed during the elections. The current status of this information may be different. For the latest available information, please refer to the affidavit filed by the candidate to the Election Commission in the most recent election.

Data Readability Report of Liabilities :No Problems in Reading Affidavit Information

Profession or Occupation

Self Politician
Spouse House wife

Sources Of Income (Details)

Self Agricultural and Rental Income
Spouse Agricultural and Rental income
Dependent Nil

Contracts with appropriate Govt. and any public company/companies

Details of contracts entered by the candidate Nil
Details of contracts entered into by spouse Nil
Details of contracts entered into by dependent Nil
Details of contracts entered into by Hindu undivided family or trust in which the candidate or spouse or dependents have interest Nil
Details of contracts entered into by Partnership Firms in which the candidate or spouse or dependents are partners Nil
Details of contracts entered into by Private Companies in which candidate or spouse or dependents have share Nil



If you notice any discrepancy between affidavits and our data, you can use the message box below to send a message to us.

( यदि आप हलफनामों और इस पेज पर दी गयी जानकारी के बीच कोई विसंगति/भिन्नता पाते है तो आप नीचे के संदेश बॉक्स के उपयोग से हमें संदेश भेज सकते हैं)

Name
Email
Phone No
Enter your discrepancy
Please enter the code shown below and click Submit.



Share On:
Download App Follow us on

Disclaimer: All information on this website has been taken by ADR from the website of the Election Commission of India (https://affidavitarchive.nic.in/) and all the information is available in public domain. ADR does not add or subtract any information, unless the EC changes the data. In particular, no unverified information from any other source is used. While all efforts have been made by ADR to ensure that the information is in keeping with what is available in the ECI website, in case of discrepancy between information provided by ADR through this report, anyone and that given in the ECI website, the information available on the ECI website should be treated as correct and Association for Democratic Reforms and their volunteers are not responsible or liable for any direct, indirect special, or consequential damages, claims, demands, losses of any kind whatsoever, made, claimed, incurred or suffered by any party arising under or relating to the usage of data provided by ADR through this report. It is to be noted that ADR undertakes great care and adopts utmost due diligence in analysing and dissemination of the background information of the candidates furnished by them at the time of elections from the duly self-sworn affidavits submitted with the Election Commission of India. Such information is only aimed at highlighting the growing criminality in politics, increased misuse of money in elections so as to facilitate a system of transparency, accountability and good governance and to enable voters to form an informed choice. Therefore, it is expected that anyone using this report shall undertake due care and utmost precaution while using the data provided by ADR. ADR is not responsible for any mishandling, discrepancy, inability to understand, misinterpretation or manipulation, distortion of the data in such a way so as to benefit or target a particular political party or politician or candidate.

About MyNeta About ADR State Coordinators Contact Terms of Use FAQs