Myneta.info is an open data repository platform of Association for Democratic Reforms (ADR).
Myneta Logo Myneta Logo
Home Lok Sabha State Assemblies Rajya Sabha Political Parties Electoral Bonds || माय नेता हिंदी में || About MyNeta About ADR
State Assemblies Rajya Sabha Political Parties
1 2 3 4
HomeTamilNadu 2026NAGAPATTINAMVEDHARANYAMKINGSLY GERALD. A(Criminal & Asset Declaration)

TamilNadu 2026

profile image

KINGSLY GERALD. A

VEDHARANYAM (NAGAPATTINAM)
Party:Tamilaga Vettri Kazhagam
S/o|D/o|W/o: Mr.Arputharaj
Age: 49
Name Enrolled as Voter in: 164 Keezhvelur constituency, at Serial no 211 in Part no 87

Self Profession:Lawyer and Building Rent
Spouse Profession:Housewife and Self Employed

Crime-O-Meter


Number of Criminal Cases: 2

Assets & Liabilities


Assets: Rs 38,22,47,739 ~38 Crore+
Liabilities: Rs 1,29,65,396 ~1 Crore+

Educational Details


Category: Graduate Professional
BL from Central Law College, Salem in 2000, B.com fromThooyavalanar College, Tiruchirappali in 1996, 12th Grade from Seventh Day Adventist High School, Chennai in 1993, 10th from Nehru Matriculation Higher Secondary School, Nagapattina in 1991

Details of PAN and status of Income Tax return

Relation TypePAN GivenFinancial YearTotal Income Shown in ITR
selfY2024 - 20252024 - 2025 ** Rs 12,41,919 ~ 12 Lacs+
2023 - 2024 ** Rs 11,76,292 ~ 11 Lacs+
2022 - 2023 ** Rs 11,57,552 ~ 11 Lacs+
2021 - 2022 ** Rs 8,23,740 ~ 8 Lacs+
2020 - 2021 ** Rs 6,15,110 ~ 6 Lacs+
spouseY2024 - 20252024 - 2025 ** Rs 11,39,400 ~ 11 Lacs+
2023 - 2024 ** Rs 11,04,590 ~ 11 Lacs+
2022 - 2023 ** Rs 11,13,452 ~ 11 Lacs+
2021 - 2022 ** Rs 8,01,920 ~ 8 Lacs+
2020 - 2021 ** Rs 5,93,740 ~ 5 Lacs+
hufNNoneNone ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
dependent1NNoneNone ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
dependent2NNoneNone ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
dependent3NNoneNone ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
Data Readability Report of PAN and Income Tax :No Problems in Reading Affidavit Information

Details of Criminal Cases

Brief Details of IPC / BNS

Cases where Pending

Serial No.FIR No.Case No.Court LAW / Section Type IPC/BNS Sections ApplicableOther Details / Other Acts / Sections Applicable Charges Framed Date on which charges were framedAppeal FiledDetails and present status of appeal
1 Crime No. 484/2022 was registered at Velipalayam Police Station, Nagapattinam District and later changed to Crime No. 1/2024 at the Crime Branch, Criminal Investigation Department, Nagapattinam Police Station. C.C. No. 836/2025 Honorable Chief Judicial Magistrate Court, Nagapattinam IPC 419, 420, 419, 109, 120B, 465, 468, 471, 420 No No
2 Crime No. 48/2025, Nagapattinam District, Keezhayur Police Station BNS 126, 189(2), 223 No No

Cases where Convicted

Serial No.Case No.Court LAW / Section Type IPC/BNS Sections ApplicableOther Details / Other Acts / Sections Applicable Punishment ImposedDate on which convictedAppeal FiledDetails and present status of appeal
---------No Cases--------

Disclaimer: This information is an archive of the candidate's self-declared affidavit that was filed during the elections. The current status of this information may be different. For the latest available information, please refer to the affidavit filed by the candidate to the Election Commission in the most recent election.

Data Readability Report of Criminal Cases :No Problems in Reading Affidavit Information

Details of Movable Assets

Sr NoDescriptionselfspousehufdependent1dependent2dependent3
iCash 1,00,000  1 Lacs+

50,000  50 Thou+

NilNilNilNil Rs 1,50,000
1 Lacs+
iiDeposits in Banks, Financial Institutions and Non-Banking Financial CompaniesTamilnad Mercantile Bank Nagapattinam Branch
2,162  2 Thou+

ICIC Bank, Nagapattinam Branch
8,359  8 Thou+

HDF? BANK, Nagapattinam Branch
9,186  9 Thou+

Canara Bank, Velankanni Branch,
20,286  20 Thou+

State Bank of India, Nagapattinam Branch
3,375  3 Thou+

South Indian Bank, Nagapattinam branch
15,888  15 Thou+

Indian Bank, Velankanni Branch
12,308  12 Thou+

Indian Overseas Bank, Velankanni Branch
48,875  48 Thou+

Bank of India, Nagapattinam Branch
25,890  25 Thou+

Axis Bank, Nagapattinam Branch
90,713  90 Thou+

Tamilnad Mercantile Bank Nagapattinam Branch
10,000  10 Thou+

Tamilnad Mercantile Bank Nagapattinam Branch
2,875  2 Thou+

Tamilnad Mercantile Bank Nagapattinam Branch
19,470  19 Thou+

ICICI Bank, Nagapattinam Branch
20,437  20 Thou+

Canara Bank, Velankanni Branch
16,877  16 Thou+

Karur Vysya Bank, Nagapattinam branch
6,035  6 Thou+

State Bank of India, Nagapattinam Branch
5,506  5 Thou+

Union Bank of India, Nagapattinam Branch
12,414  12 Thou+

HDFC Bank, Nagapattinam Branch
1,43,306  1 Lacs+

Indian Bank, Velankanni Branch
19,378  19 Thou+

South Indian Bank, Velankanni Branch
46,499  46 Thou+

City Union Bank, Manjakolai Branch
9,960  9 Thou+

Indian Overseas Bank, Velankanni Branch
1,173  1 Thou+

Tamilnad Mercantile Bank Nagapattinam Branch
10,000  10 Thou+

NilIndian Overseas Bank, Velankanni Branch
1,419  1 Thou+

NilNil Rs 5,62,391
5 Lacs+
iiiBonds, Debentures and Shares in companiesNilNilNilNilNilNil Nil
iv(a)
NSS, Postal Savings etc
NilNilNilNilNilNil Nil
(b)
LIC or other insurance Policies
LIC Policy
5,00,000  5 Lacs+

LIC Policy
4,00,000  4 Lacs+

LIC Policy
15,00,000  15 Lacs+

ICICI Insurance
1,21,000  1 Lacs+

ICICI Insurance
5,00,000  5 Lacs+

Star Health Insurance
15,287  15 Thou+

LIC Policy
2,00,000  2 Lacs+

LIC Policy
1,00,000  1 Lacs+

LIC Policy
10,00,000  10 Lacs+

NilLIC Policy
2,00,000  2 Lacs+

LIC Policy
10,00,000  10 Lacs+

LIC Policy
10,00,000  10 Lacs+

LIC Policy
10,00,000  10 Lacs+

Nil Rs 75,36,287
75 Lacs+
vPersonal loans/advance given NilNilNilNilNilNil Nil
viMotor Vehicles (details of make, etc.)ROYAL ENFIELD, TN 51 AA 5657
1,20,000  1 Lacs+

Innova, TN 90 2107
13,50,000  13 Lacs+

YAM???, TN 51 AP 5657
95,000  95 Thou+

NilNilNilNil Rs 15,65,000
15 Lacs+
viiJewellery (give details weight value)67 Sovereigns of Gold Jewellary
73,70,000  73 Lacs+

120 Soverreigns of Gold jewellary
1,32,00,000  1 Crore+

Nil20 Soverreigns of Gold
22,00,000  22 Lacs+

10 Soverreigns of Gold Jewellary
11,00,000  11 Lacs+

Nil Rs 2,38,70,000
2 Crore+
viiiOther assets, such as values of claims / interestsNilNilNilNilNilNil Nil
Gross Total Value (as per Affidavit) 1,08,73,334  1 Crore+ 1,63,08,936  1 Crore+ Nil 34,01,419  34 Lacs+ 31,00,00,000  31 Crore+ Nil Rs 34,05,83,689
34 Crore+
Totals (Calculated as Sum of Values) Rs 1,08,73,329
1 Crore+
Rs 1,63,08,930
1 Crore+
Nil
Rs 34,01,419
34 Lacs+
Rs 31,00,000
31 Lacs+
Nil
Rs 3,36,83,678
3 Crore+

Disclaimer: This information is an archive of the candidate's self-declared affidavit that was filed during the elections. The current status of this information may be different. For the latest available information, please refer to the affidavit filed by the candidate to the Election Commission in the most recent election.

Data Readability Report of Movable Assets :No Problems in Reading Affidavit Information

Details of Immovable Assets

Sr NoDescriptionselfspousehufdependent1dependent2dependent3
iAgricultural LandNilNilNilNilNilNil Nil
iiNon Agricultural LandVenlankanni, 84/5A1
Total Area 2180 sqft
Built Up Area
Whether Inherited N
Purchase Date 2007-11-30
Purchase Cost 641200.00
Development Cost 0.00
20,27,500  20 Lacs+

Venlankanni, 84/5A1
Total Area 2670 sqft
Built Up Area
Whether Inherited N
Purchase Date 2008-06-11
Purchase Cost 524000.00
Development Cost 0.00
24,82,880  24 Lacs+

Venlankanni, 17/28
Total Area 1615 sqft
Built Up Area
Whether Inherited N
Purchase Date 2010-04-07
Purchase Cost 0.00
Development Cost 0.00
15,84,000  15 Lacs+

Venlankanni, 17/33
Total Area 1776 sqft
Built Up Area
Whether Inherited N
Purchase Date 2012-03-29
Purchase Cost 627000.00
Development Cost 0.00
20,27,500  20 Lacs+

Venlankanni, 84/5A1A1
Total Area 1744 sqft
Built Up Area
Whether Inherited N
Purchase Date 2018-02-13
Purchase Cost 1308000.00
Development Cost 0.00
17,10,720  17 Lacs+

Venlankanni, 84/22
Total Area 3230 sqft
Built Up Area
Whether Inherited N
Purchase Date 2018-05-16
Purchase Cost 1920000.00
Development Cost 0.00
30,03,000  30 Lacs+

Venlankanni, 92/4B
Total Area 545 sqft
Built Up Area
Whether Inherited N
Purchase Date 2022-03-14
Purchase Cost 7600000.00
Development Cost 0.00
1,10,09,950  1 Crore+

Venlankanni, 84/5A2A
Total Area 880 sqft
Built Up Area
Whether Inherited N
Purchase Date 2020-11-03
Purchase Cost 212000.00
Development Cost 0.00
8,18,500  8 Lacs+

NilNilNilNil Rs 2,46,64,050
2 Crore+
iiiCommercial BuildingsVenlankanni, 12/15
Total Area 1400 sqft
Built Up Area
Whether Inherited N
Purchase Date 2003-07-01
Purchase Cost 161115.00
Development Cost 7000000.00
90,00,000  90 Lacs+

NilNilNilNilNil Rs 90,00,000
90 Lacs+
ivResidential BuildingsNilVelankaani Kivelur Taluk, 84/5A2
Total Area 8375 sqft
Built Up Area 2400 sqft
Whether Inherited N
Purchase Date 2007-08-20
Purchase Cost 1132063.00
Development Cost 4000000.00
80,00,000  80 Lacs+

NilNilNilNil Rs 80,00,000
80 Lacs+
vOthersNilNilNilNilNilNil Nil
Total Current Market Value of (i) to (v) (as per Affidavit) 3,28,45,550  3 Crore+ 88,18,500  88 Lacs+ Nil Nil Nil Nil Rs 4,16,64,050
4 Crore+
Totals Calculated Rs 3,28,45,550
3 Crore+
Rs 88,18,500
88 Lacs+
Nil
Nil
Nil
Nil
Rs 4,16,64,050
4 Crore+

Disclaimer: This information is an archive of the candidate's self-declared affidavit that was filed during the elections. The current status of this information may be different. For the latest available information, please refer to the affidavit filed by the candidate to the Election Commission in the most recent election.

Data Readability Report of Immovable Assets :No Problems in Reading Affidavit Information

Details of Liabilities

Sr NoDescriptionselfspousehufdependent1dependent2dependent3
iLoans from Banks / FIsTamilnad Mercantile Bank, Nagapattinam Branch
47,08,399  47 Lacs+

Tamilnad Mercantile Bank, Nagapattinam Branch,
6,52,765  6 Lacs+

Tamilnad Mercantile Bank, Nagapattinam Branch
8,23,483  8 Lacs+

Tamilnad Mercantile Bank, Nagapattinam Branch
11,24,748  11 Lacs+

Tamilnad Mercantile Bank, Nagapattinam Branch
14,25,819  14 Lacs+

Indian Bank, Velankanni Branch
9,80,000  9 Lacs+

Term Loan Indian Overseas Bank, Velankanni Branch
32,50,182  32 Lacs+

NilNilNilNil Rs 1,29,65,396
1 Crore+
Loans due to Individual / EntityNilNilNilNilNilNil Nil
Any other LiabilityNilNilNilNilNilNil Nil
Grand Total of Liabilities (as per affidavit) 47,08,399  47 Lacs+ 82,56,997  82 Lacs+ Nil Nil Nil Nil Rs 1,29,65,396
1 Crore+
iiDues to departments dealing with government accommodationNilNilNilNilNilNil Nil
Dues to departments dealing with supply of waterNilNilNilNilNilNil Nil
Dues to departments dealing with supply of electricityNilNilNilNilNilNil Nil
Dues to departments dealing with telephonesNilNilNilNilNilNil Nil
Dues to departments dealing with supply of transportNilNilNilNilNilNil Nil
Income Tax DuesNilNilNilNilNilNil Nil
Wealth Tax DuesNilNilNilNilNilNil Nil
Service Tax DuesNilNilNilNilNilNil Nil
Property Tax DuesNilNilNilNilNilNil Nil
Sales Tax DuesNilNilNilNilNilNil Nil
GST DuesNilNilNilNilNilNil Nil
Any Other DuesNilNilNilNilNilNil Nil
iiiGrand Total of all Govt Dues (as per affidavit) Nil Nil Nil Nil Nil Nil Nil
ivWhether any other liabilities are in dispute, if so, mention the amount involved and the authority before which it is pendingNilNilNilNilNilNil Nil
Totals (Calculated as Sum of Values) Rs 47,08,399
47 Lacs+
Rs 82,56,997
82 Lacs+
Nil
Nil
Nil
Nil
Rs 1,29,65,396
1 Crore+

Disclaimer: This information is an archive of the candidate's self-declared affidavit that was filed during the elections. The current status of this information may be different. For the latest available information, please refer to the affidavit filed by the candidate to the Election Commission in the most recent election.

Data Readability Report of Liabilities :No Problems in Reading Affidavit Information

Profession or Occupation .

Self Lawyer and Building Rent
Spouse Housewife and Self Employed

Sources Of Income (Details)

Self Lawyer and Building Rent
Spouse Housewife and Self Employed
Dependent N/A

Contracts with appropriate Govt. and any public company/companies

Details of contracts entered by the candidate
Details of contracts entered into by spouse
Details of contracts entered into by dependent
Details of contracts entered into by Hindu undivided family or trust in which the candidate or spouse or dependents have interest
Details of contracts entered into by Partnership Firms in which the candidate or spouse or dependents are partners
Details of contracts entered into by Private Companies in which candidate or spouse or dependents have share



If you notice any discrepancy between affidavits and our data, you can use the message box below to send a message to us.

( यदि आप हलफनामों और इस पेज पर दी गयी जानकारी के बीच कोई विसंगति/भिन्नता पाते है तो आप नीचे के संदेश बॉक्स के उपयोग से हमें संदेश भेज सकते हैं)

Name
Email
Phone No
Enter your discrepancy
Please enter the code shown below and click Submit.



Share On:
Download App Follow us on

Disclaimer: All information on this website has been taken by ADR from the website of the Election Commission of India (https://affidavitarchive.nic.in/) and all the information is available in public domain. ADR does not add or subtract any information, unless the EC changes the data. In particular, no unverified information from any other source is used. While all efforts have been made by ADR to ensure that the information is in keeping with what is available in the ECI website, in case of discrepancy between information provided by ADR through this report, anyone and that given in the ECI website, the information available on the ECI website should be treated as correct and Association for Democratic Reforms and their volunteers are not responsible or liable for any direct, indirect special, or consequential damages, claims, demands, losses of any kind whatsoever, made, claimed, incurred or suffered by any party arising under or relating to the usage of data provided by ADR through this report. It is to be noted that ADR undertakes great care and adopts utmost due diligence in analysing and dissemination of the background information of the candidates furnished by them at the time of elections from the duly self-sworn affidavits submitted with the Election Commission of India. Such information is only aimed at highlighting the growing criminality in politics, increased misuse of money in elections so as to facilitate a system of transparency, accountability and good governance and to enable voters to form an informed choice. Therefore, it is expected that anyone using this report shall undertake due care and utmost precaution while using the data provided by ADR. ADR is not responsible for any mishandling, discrepancy, inability to understand, misinterpretation or manipulation, distortion of the data in such a way so as to benefit or target a particular political party or politician or candidate.

About MyNeta About ADR State Coordinators Contact Terms of Use FAQs