Myneta.info is an open data repository platform of Association for Democratic Reforms (ADR).
Myneta Logo Myneta Logo
Home Lok Sabha State Assemblies Rajya Sabha Political Parties Electoral Bonds || माय नेता हिंदी में || About MyNeta About ADR
State Assemblies Rajya Sabha Political Parties
1 2 3 4
HomeTamil Nadu 2021NAGAPATTINAMVEDHARANYAMV.VEERAKUMAR(Declaration of Election Expenses))

Tamil Nadu 2021

V.VEERAKUMAR

Party:IND
S/o|D/o|W/o: Veerasamy
Age: 32
Name Enrolled as Voter in: Vedharanyam constituency, at Serial no 884 in Part no 110

Self Profession:Agriculture
Spouse Profession:Nil


Abstract Statement Of Expenditure On Election

Item of Expediture Expediture incurred/authorised by Calculated Total expeses
incurred/
authorized
(Total of
Columns 2,
3 & 4)
Given Total expenses
incurred/authorized
as declared by candidate
Candidate/his
election
agent
Political party
which setup
him up
Any other
association/
body of
persons/
individual
123456

i a . Expenses in public meeting, rally,procession etc. (ie:other than the ones with Star Campaigners of the Political party (Enclose as per Schedule-1)
15,750   15 Thou+ Nil    Nil    15,750   15 Thou+ 15,750   15 Thou+

i b .Expenditure in public meeting rally, procession etc. with the Star Campaigner(s) (ie:other than those for general party propaganda) (Enclose as per Schedule-2)
Nil    Nil    Nil    0       
ii.Campaign materials,like handbills,posters,video
audio cassettes,loudspeakers etc.
Nil    Nil    Nil    0       
iii.Campaign through electronic/print media
(including cable network).
Nil    Nil    Nil    0       
iv.Vehicles used and POL expenditure on such vehicles. 12,000   12 Thou+ Nil    Nil    12,000   12 Thou+ 12,000   12 Thou+
v.Expenses on campaign workers. Nil    Nil    Nil    0       
vi.Expenses incurred on publishing of declaration regarding criminal cases. Nil    Nil    Nil    0       
vii.Other misc expenses. Nil    Nil    Nil    0       
viii.Expenses incurred on Virtual Campaign (Enclose as per Schedule 11) Nil    . Nil    .. Nil    ... 0    ....    
Calculated Column Total 27,750   27 Thou+ 0    0    27,750   27 Thou+ 27,750   27 Thou+
Total Given by candidate 27,750   27 Thou+ Nil    Nil   


CALCULATED GRAND TOTAL:- 27,750    27 Thou+



GRAND TOTAL GIVEN BY CANDIDATE:-27,750   27 Thou+

Comment





PART III : ABSTRACT OF SOURCE OF FUNDS RAISED BY CANDIDATE

Received FromDetailsTotal
iAmount of own fund used for the election campaign27,750  27 Thou+
27,750   27 Thou+
iiLump sum amount received from the party (ies) in cash or cheque etc.Nil   
iiiLump sum amount received from any person/ company/ firm/ associations / body of persons etc. as loan, gift or donation etc.Nil    
iiiTotal Given by Candidate
(Enter this total only if breakup is not given in the columns above)
27,750  27 Thou+
27,750   27 Thou+
Total27,750   27 Thou+

Affidavit Data Quality Information

Expensesok


Share On:
Download App Follow us on

Disclaimer: All information on this website has been taken by ADR from the website of the Election Commission of India (https://affidavitarchive.nic.in/) and all the information is available in public domain. ADR does not add or subtract any information, unless the EC changes the data. In particular, no unverified information from any other source is used. While all efforts have been made by ADR to ensure that the information is in keeping with what is available in the ECI website, in case of discrepancy between information provided by ADR through this report, anyone and that given in the ECI website, the information available on the ECI website should be treated as correct and Association for Democratic Reforms and their volunteers are not responsible or liable for any direct, indirect special, or consequential damages, claims, demands, losses of any kind whatsoever, made, claimed, incurred or suffered by any party arising under or relating to the usage of data provided by ADR through this report. It is to be noted that ADR undertakes great care and adopts utmost due diligence in analysing and dissemination of the background information of the candidates furnished by them at the time of elections from the duly self-sworn affidavits submitted with the Election Commission of India. Such information is only aimed at highlighting the growing criminality in politics, increased misuse of money in elections so as to facilitate a system of transparency, accountability and good governance and to enable voters to form an informed choice. Therefore, it is expected that anyone using this report shall undertake due care and utmost precaution while using the data provided by ADR. ADR is not responsible for any mishandling, discrepancy, inability to understand, misinterpretation or manipulation, distortion of the data in such a way so as to benefit or target a particular political party or politician or candidate.

About MyNeta About ADR State Coordinators Contact Terms of Use FAQs