Myneta.info is an open data repository platform of Association for Democratic Reforms (ADR).
Myneta Logo Myneta Logo
Home Lok Sabha State Assemblies Rajya Sabha Political Parties Electoral Bonds || माय नेता हिंदी में || About MyNeta About ADR
State Assemblies Rajya Sabha Political Parties
1 2 3 4
HomeAndhra Pradesh 2019VISAKHAPATNAMYELAMANCHILIMYLAPALLI RAJARAO(Criminal & Asset Declaration)

Andhra Pradesh 2019

MYLAPALLI RAJARAO

YELAMANCHILI (VISAKHAPATNAM)
Party:BJP
S/o|D/o|W/o: Mylapalli Bangaraiah
Age: 40
Name Enrolled as Voter in: Yelamanchili-32 (Andhra Pradesh) constituency, at Serial no 388 in Part no 267

Self Profession:Business
Spouse Profession:Business

Other Elections
Declaration inDeclared AssetsDeclared Cases
Andhra Pradesh 2014Rs1,52,54,480
~1 Crore+
0
Click here for more details

Print Profile
View Candidate Election Expenses



Crime-O-Meter


No criminal cases

Assets & Liabilities


Assets: Rs 5,44,10,163 ~5 Crore+
Liabilities: Rs 1,30,69,630 ~1 Crore+

Educational Details


Category: Graduate Professional
B.Arch (Architecture) in the year 2011 in JNTU, Masab Tank, Hyderabad

Details of PAN and status of Income Tax return

Relation TypePAN GivenFinancial YearTotal Income Shown in ITR
selfY2017 - 20182017 - 2018 ** Rs 20,63,663 ~ 20 Lacs+
2016 - 2017 ** Rs 17,59,070 ~ 17 Lacs+
2015 - 2016 ** Rs 14,66,749 ~ 14 Lacs+
2014 - 2015 ** Rs 15,07,486 ~ 15 Lacs+
2013 - 2014 ** Rs 9,35,074 ~ 9 Lacs+
spouseY2017 - 20182017 - 2018 ** Rs 5,50,436 ~ 5 Lacs+
2016 - 2017 ** Rs 5,06,340 ~ 5 Lacs+
2015 - 2016 ** Rs 4,02,350 ~ 4 Lacs+
None ** Rs 0 ~
None ** Rs 0 ~
hufNNoneNone ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
dependent1NNoneNone ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
dependent2NNoneNone ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
dependent3NNoneNone ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
Data Readability Report of PAN and Income Tax :No Problems in Reading Affidavit Information

Details of Criminal Cases

No criminal cases

Disclaimer: This information is an archive of the candidate's self-declared affidavit that was filed during the elections. The current status of this information may be different. For the latest available information, please refer to the affidavit filed by the candidate to the Election Commission in the most recent election.

Data Readability Report of Criminal Cases :No Problems in Reading Affidavit Information

Details of Movable Assets

Sr NoDescriptionselfspousehufdependent1dependent2dependent3
iCash 25,000  25 Thou+

2,40,000  2 Lacs+

NilNilNilNil Rs 2,65,000
2 Lacs+
iiDeposits in Banks, Financial Institutions and Non-Banking Financial CompaniesDevelopment Credit Bank, Dr. A.S.Rao Nagar, Br, Hyderabad A/c.No. 05 142600000046 Dt:24-3-2019
6,10,162.69  6 Lacs+

Developrnent Credit Bank, Dr. A.S.Rao Nagar. Br, Hyderabad A/c.No. 05 r22900000064 Dt:24-3-2019
54,169.70  54 Thou+

Development Credit Bank. Dr. A.S.Rao Nagar. Br, Hyderabad A/c.No.051 10r00003827 Dt:24-3-2019
2,18,202.97  2 Lacs+

HDFC Bank Sainikpuri Br. Hyderabad (oint) A/c No.50l00l15276 798 Dt:24-3-2019
67,861.50  67 Thou+

Bank of Baroda. Yelamanchili Br. Yelamanchili, Alc No.l4l80l0002l 515 Dt:24-3-2019
2,60,000  2 Lacs+

Development Credit Bank, Dr. A.S.Rao Nagar, Br, Hyderabad A/c.No. 05 1 r 29000007 63 Dt:24-3-2019
1,15,090.26  1 Lacs+

Indian Overseas Bank, ECIL Br, Hyderabad A/c.No. 15850t 000010 353 Dt:24-3-2019
9,523.35  9 Thou+

NilNilNilNil Rs 13,35,010.47
13 Lacs+
iiiBonds, Debentures and Shares in companiesNilNilNilNilNilNil Nil
iv(a)
NSS, Postal Savings etc
NilNilNilNilNilNil Nil
(b)
LIC or other insurance Policies
Max Life Insurance, Policy No: 234620797 Dt: l6-08-2003
4,84,152  4 Lacs+

NilNilNilNilNil Rs 4,84,152
4 Lacs+
vPersonal loans/advance given NilNilNilNilNilNil Nil
viMotor Vehicles (details of make, etc.)TOYOTA INNOVA Dt of Reg:17109/2012 Reg No.AP294,Wl68 9
17,00,000  17 Lacs+

)HYTINDAI SANTRO Xing Reg No.AP29R4060 Reg Dt:20-12- 2006
4,25,000  4 Lacs+

)HYUNDAI I20 Reg No.TS08ET7679 Reg Dt: Feb 2016
11,25,000  11 Lacs+

NilNilNilNilNil Rs 32,50,000
32 Lacs+
viiJewellery (give details weight value)Gold 70 grams @Rs.2,8001
1,96,000  1 Lacs+

Gold 250 grams @Rs.2,8001
7,00,000  7 Lacs+

NilNilNilNil Rs 8,96,000
8 Lacs+
viiiOther assets, such as values of claims / interestsNilNilNilNilNilNil Nil
Gross Total Value (as per Affidavit) 51,65,548.86  51 Lacs+ 10,64,614  10 Lacs+ Nil Nil Nil Nil Rs 62,30,162.86
62 Lacs+
Totals (Calculated as Sum of Values) Rs 51,65,548.86
51 Lacs+
Rs 10,64,613.61
10 Lacs+
Nil
Nil
Nil
Nil
Rs 62,30,162.47
62 Lacs+

Disclaimer: This information is an archive of the candidate's self-declared affidavit that was filed during the elections. The current status of this information may be different. For the latest available information, please refer to the affidavit filed by the candidate to the Election Commission in the most recent election.

Data Readability Report of Movable Assets :No Problems in Reading Affidavit Information

Details of Immovable Assets

Sr NoDescriptionselfspousehufdependent1dependent2dependent3
iAgricultural LandNilNilNilNilNilNil Nil
iiNon Agricultural LandPl: PoltNo.55 Mint Colony Cherlapally, Hyderabad. Survey No. 190,Pl:368 sq yards
Total Area 368 sqyards
Built Up Area
Whether Inherited N
Purchase Date 2004-03-22
Purchase Cost 121500.00
Development Cost 0.00
18,40,000  18 Lacs+

P2: Polt No.3 l4 Gandhi Nagar. Yamanpet Hyderabad, Survey No. 128. 129, t30, 13l & 132
Total Area 400 sqyards
Built Up Area
Whether Inherited N
Purchase Date 2006-08-24
Purchase Cost 200000.00
Development Cost 0.00
20,00,000  20 Lacs+

Plot No: 49P. 50P Lake View Colony, Dammaiguda, Hyderabad, Suyvey No. 524, 525.526.527
Total Area 506 sqyards
Built Up Area
Whether Inherited N
Purchase Date 2007-01-27
Purchase Cost 455500.00
Development Cost 0.00
25,30,000  25 Lacs+

NilNilNilNil Rs 63,70,000
63 Lacs+
iiiCommercial BuildingsSouth Kamala Nagar ECIL., Hyderabad Shop in l" floor Survey No. Pl:315
Total Area 9.5 sqyards
Built Up Area 345 sqft
Whether Inherited N
Purchase Date 0000-00-00
Purchase Cost 373000.00
Development Cost 1000000.00
25,00,000  25 Lacs+

South Kamala Nagar ECIL., Hyderabad Shop in l" floor Survey No. Pl:315
Total Area 2.9 sqyards
Built Up Area 320 sqft
Whether Inherited N
Purchase Date 2007-05-23
Purchase Cost 235000.00
Development Cost 1000000.00
22,00,000  22 Lacs+

South Kamala Nagar ECIL, Hyderabad (Joint) Shop in ground floor Survey No. 315
Total Area 20 sqyards
Built Up Area 550 sqft
Whether Inherited N
Purchase Date 2017-11-30
Purchase Cost 1210000.00
Development Cost 900000.00
21,10,000  21 Lacs+

New narasimhanagar colony, Mallapur, Hyderabad PlotNo.l27, 128, 134, 135 Survey No.2/l/l
Total Area 514 sqyards
Built Up Area 11653 sqft
Whether Inherited N
Purchase Date 2014-11-15
Purchase Cost 10840000.00
Development Cost 0.00
1,70,00,000  1 Crore+

NilNilNilNil Rs 2,38,10,000
2 Crore+
ivResidential Buildings Flat No: 102. Patel wisdom, Kondapur, Hyderabad, Survey No: l3/A. Plot No:l
Total Area 38.61 sq yards
Built Up Area 1358 sqft
Whether Inherited N
Purchase Date 2017-05-18
Purchase Cost 2716000.00
Development Cost 500000.00
45,00,000  45 Lacs+

: Gaudapur colony. Kapra. Hvderabad Joint (Duplex House) Plot no I l5P, r l6P, I l8P. r r9P Survey No: 5 13. 514.525
Total Area 150 sqyards
Built Up Area 2390 sqft
Whether Inherited N
Purchase Date 2018-12-22
Purchase Cost 6000000.00
Development Cost 1500000.00
75,00,000  75 Lacs+

Gaudapur colony, Kapr4 Hyderabad, (Duplex House) Plot no I l8P, r l9P, 124P, r25P Survey No: 5 13, 5t4,525
Total Area 150 sq yards
Built Up Area 2390 sqft
Whether Inherited N
Purchase Date 2007-03-24
Purchase Cost 675000.00
Development Cost 3325000.00
60,00,000  60 Lacs+

NilNilNilNil Rs 1,80,00,000
1 Crore+
vOthersNilNilNilNilNilNil Nil
Total Current Market Value of (i) to (v) (as per Affidavit) 2,05,40,000  2 Crore+ 2,76,40,000  2 Crore+ Nil Nil Nil Nil Rs 4,81,80,000
4 Crore+
Totals Calculated Rs 2,05,40,000
2 Crore+
Rs 2,76,40,000
2 Crore+
Nil
Nil
Nil
Nil
Rs 4,81,80,000
4 Crore+

Disclaimer: This information is an archive of the candidate's self-declared affidavit that was filed during the elections. The current status of this information may be different. For the latest available information, please refer to the affidavit filed by the candidate to the Election Commission in the most recent election.

Data Readability Report of Immovable Assets :No Problems in Reading Affidavit Information

Details of Liabilities

Sr NoDescriptionselfspousehufdependent1dependent2dependent3
iLoans from Banks / FIsDevelopment Credit Bank, Dr. A.S.Rao Nagar, Br, Hyderabad Joint OD05 142600000046 Dt:24/03/2019
1,30,69,630  1 Crore+

NilNilNilNilNil Rs 1,30,69,630
1 Crore+
Loans due to Individual / EntityNilNilNilNilNilNil Nil
Any other LiabilityNilNilNilNilNilNil Nil
Grand Total of Liabilities (as per affidavit) 1,30,69,630  1 Crore+ Nil Nil Nil Nil Nil Rs 1,30,69,630
1 Crore+
iiDues to departments dealing with government accommodationNilNilNilNilNilNil Nil
Dues to departments dealing with supply of waterNilNilNilNilNilNil Nil
Dues to departments dealing with supply of electricityNilNilNilNilNilNil Nil
Dues to departments dealing with telephonesNilNilNilNilNilNil Nil
Dues to departments dealing with supply of transportNilNilNilNilNilNil Nil
Income Tax DuesNilNilNilNilNilNil Nil
Wealth Tax DuesNilNilNilNilNilNil Nil
Service Tax DuesNilNilNilNilNilNil Nil
Property Tax DuesNilNilNilNilNilNil Nil
Sales Tax DuesNilNilNilNilNilNil Nil
GST DuesNilNilNilNilNilNil Nil
Any Other DuesNilNilNilNilNilNil Nil
iiiGrand Total of all Govt Dues (as per affidavit) Nil Nil Nil Nil Nil Nil Nil
ivWhether any other liabilities are in dispute, if so, mention the amount involved and the authority before which it is pendingNilNilNilNilNilNil Nil
Totals (Calculated as Sum of Values) Rs 1,30,69,630
1 Crore+
Nil
Nil
Nil
Nil
Nil
Rs 1,30,69,630
1 Crore+

Disclaimer: This information is an archive of the candidate's self-declared affidavit that was filed during the elections. The current status of this information may be different. For the latest available information, please refer to the affidavit filed by the candidate to the Election Commission in the most recent election.

Data Readability Report of Liabilities :No Problems in Reading Affidavit Information

Profession or Occupation

Self Business
Spouse Business

Sources Of Income (Details)

Self Business
Spouse Business
Dependent No

Contracts with appropriate Govt. and any public company/companies

Details of contracts entered by the candidate NIL
Details of contracts entered into by spouse NIL
Details of contracts entered into by dependent NIL
Details of contracts entered into by Hindu undivided family or trust in which the candidate or spouse or dependents have interest NIL
Details of contracts entered into by Partnership Firms in which the candidate or spouse or dependents are partners NIL
Details of contracts entered into by Private Companies in which candidate or spouse or dependents have share NIL



If you notice any discrepancy between affidavits and our data, you can use the message box below to send a message to us.

( यदि आप हलफनामों और इस पेज पर दी गयी जानकारी के बीच कोई विसंगति/भिन्नता पाते है तो आप नीचे के संदेश बॉक्स के उपयोग से हमें संदेश भेज सकते हैं)

Name
Email
Phone No
Enter your discrepancy
Please enter the code shown below and click Submit.




Share On:
Download App Follow us on

Disclaimer: All information on this website has been taken by ADR from the website of the Election Commission of India (https://affidavitarchive.nic.in/) and all the information is available in public domain. ADR does not add or subtract any information, unless the EC changes the data. In particular, no unverified information from any other source is used. While all efforts have been made by ADR to ensure that the information is in keeping with what is available in the ECI website, in case of discrepancy between information provided by ADR through this report, anyone and that given in the ECI website, the information available on the ECI website should be treated as correct and Association for Democratic Reforms and their volunteers are not responsible or liable for any direct, indirect special, or consequential damages, claims, demands, losses of any kind whatsoever, made, claimed, incurred or suffered by any party arising under or relating to the usage of data provided by ADR through this report. It is to be noted that ADR undertakes great care and adopts utmost due diligence in analysing and dissemination of the background information of the candidates furnished by them at the time of elections from the duly self-sworn affidavits submitted with the Election Commission of India. Such information is only aimed at highlighting the growing criminality in politics, increased misuse of money in elections so as to facilitate a system of transparency, accountability and good governance and to enable voters to form an informed choice. Therefore, it is expected that anyone using this report shall undertake due care and utmost precaution while using the data provided by ADR. ADR is not responsible for any mishandling, discrepancy, inability to understand, misinterpretation or manipulation, distortion of the data in such a way so as to benefit or target a particular political party or politician or candidate.

About MyNeta About ADR State Coordinators Contact Terms of Use FAQs